Structure of PDB 4zid Chain A |
>4zidA (length=80) Species: 608538 (Hydrogenobacter thermophilus TK-6) [Search protein sequence] |
NEQLAKQKGCMACHDLKAKKVGPAYADVAKKYAGRKDAVDYLAGKIKKGG SGVWGSVPMPPQNVTDAEAKQLAQWILSIK |
|
PDB | 4zid Domain swapping oligomerization of thermostable c-type cytochrome in E. coli cells |
Chain | A |
Resolution | 1.8 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
HEC |
A |
C10 C13 H14 |
C10 C13 H14 |
|
|
|
|