Structure of PDB 4wfa Chain A

Receptor sequence

>4wfaA (length=268) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence]

IKKYKPITNGRRNMTSLDFAEITKTTPEKSLLKPLPKKAGRNNQGKLTVR
HHGGGHKRQYRVIDFRNKDGINAKVDSIQYDPNRSANIALVVYADGEKRY
IIAPKGLEVGQIVESGAEADIKVGNALPLQNIPVGTVVHNIELKPGKGGQ
IARSAGASAQVLGKEGKYVLIRLRSGEVRMILSTCRATIGQVGNLQHELV
NVGKAGRSRWKGIRPTVRGSVMNPNDHPHGGGEGRAPIGRPSPMSPWGKP
TLGKKTRRGKKSSDKLIV

3D structure

PDB

4wfa Structural insights into species-specific features of the ribosome from the pathogen Staphylococcus aureus.

Chain

Resolution

3.392 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	A	P8 T10 N11 R13 R14 L37 K40 N44 N45 Q46 G47 K48 L49 T50 V51 H53 H54 G56 K59 R60 Q61 Y62 Y83 P85 A97 D98 G99 G149 Q153 I154 A155 R156 S157 A158 G159 Y171 L176 S178 E180 H200 E201 N204 V205 G206 K207 A208 S211 R212 W213 R217 P218 T219 V220 R221 G222 S223 V224 M225 N226 N228 D229 H232 G235 E236 G237 R238 P240 G242 P244 P246 S248 P249 W250 G251 T254 G256 K257 K258 T259 R260 S266	P6 T8 N9 R11 R12 L35 K38 N42 N43 Q44 G45 K46 L47 T48 V49 H51 H52 G54 K57 R58 Q59 Y60 Y80 P82 A94 D95 G96 G146 Q150 I151 A152 R153 S154 A155 G156 Y168 L173 S175 E177 H197 E198 N201 V202 G203 K204 A205 S208 R209 W210 R214 P215 T216 V217 R218 G219 S220 V221 M222 N223 N225 D226 H229 G232 E233 G234 R235 P237 G239 P241 P243 S245 P246 W247 G248 T251 G253 K254 K255 T256 R257 S263
BS02	MG	A	R221 V224	R218 V221

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0016740	transferase activity
GO:0019843	rRNA binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4wfa, PDBe:4wfa, PDBj:4wfa
PDBsum	4wfa
PubMed	26464510
UniProt	P60430\|RL2_STAA8 Large ribosomal subunit protein uL2 (Gene Name=rplB)

[Back to BioLiP]