Structure of PDB 3g6r Chain A

Receptor sequence
>3g6rA (length=79) Species: 10116 (Rattus norvegicus) [Search protein sequence]
SHMCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDK
IRRKNCPACRYRKCLQAGMNLEARKTKKK
3D structure
PDB3g6r DNA binding site sequence directs glucocorticoid receptor structure and activity.
ChainA
Resolution2.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A S459 R466 R489 K490 R496 S23 R30 R53 K54 R60
BS02 dna A C450 H451 Y452 K465 K490 R510 C14 H15 Y16 K29 K54 R74
BS03 ZN A C440 C443 C460 C4 C7 C24
BS04 ZN A C476 C482 C492 C495 C40 C46 C56 C59
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3g6r, PDBe:3g6r, PDBj:3g6r
PDBsum3g6r
PubMed19372434
UniProtP06536|GCR_RAT Glucocorticoid receptor (Gene Name=Nr3c1)

[Back to BioLiP]