Structure of PDB 1akh Chain A

Receptor sequence
>1akhA (length=49) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
ISPQARAFLEEVFRRKQSLNSKEKEEVAKKCGITPLQVRVWFINKRMRS
3D structure
PDB1akh Crystal structure of the MATa1/MATalpha2 homeodomain heterodimer in complex with DNA containing an A-tract.
ChainA
Resolution2.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna A K100 R115 I119 R122 M123 K24 R39 I43 R46 M47
BS02 dna A I77 R82 N120 R124 I1 R6 N44 R48
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1akh, PDBe:1akh, PDBj:1akh
PDBsum1akh
PubMed9838003
UniProtP0CY10|MATA1_YEASX Mating-type protein A1 (Gene Name=MATA1)

[Back to BioLiP]