Structure of PDB 6jo5 Chain 2

Receptor sequence

>6jo52 (length=119) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence]

WYPGATAPGDYGFDPLRLKWFREAELTNGRWAMAAVVGILFTDEVAVFAV
LEGKRYEIKLKELKNGRLAMLAFLGFCSQAAVYGKGPIETLQLHLADVGP
ETAVTVAVLCVLPMIIEAT

3D structure

PDB

6jo5 Structure of the green algal photosystem I supercomplex with a decameric light-harvesting complex I.

Chain

Resolution

2.9 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	CLA	2	W31 P33 Y49 F51	W1 P3 Y11 F13
BS02	CLA	2	D48 Y49 G50 F51 D52 F66 R67 E70 R162 M165	D10 Y11 G12 F13 D14 F21 R22 E25 R67 M70
BS03	CLA	2	F66 A69 N73	F21 A24 N28
BS04	CLA	2	T72 W76 A119 E122 R125 Y126	T27 W31 A49 E52 R55 Y56
BS05	CLA	2	R75 M78 E157	R30 M33 E62
BS06	CLA	2	K156 K159 L163	K61 K64 L68
BS07	CLA	2	K156 N160	K61 N65
BS08	CLA	2	G170 S173 Q174 T185 H189	G75 S78 Q79 T90 H94
BS09	CLA	2	H189 D192	H94 D97

Gene Ontology

	Molecular Function
GO:0016168	chlorophyll binding

	Biological Process
GO:0009416	response to light stimulus
GO:0009765	photosynthesis, light harvesting
GO:0009768	photosynthesis, light harvesting in photosystem I
GO:0015979	photosynthesis

	Cellular Component
GO:0009507	chloroplast
GO:0009522	photosystem I
GO:0009523	photosystem II
GO:0009535	chloroplast thylakoid membrane
GO:0009579	thylakoid
GO:0016020	membrane

External links