Structure of PDB 3wmm Chain 1

Receptor sequence
>3wmm1 (length=60) Species: 1050 (Thermochromatium tepidum) [Search protein sequence]
FTMNANLYKIWLILDPRRVLVSIVAFQIVLGLLIHMIVLSTDLNWLDDNI
PVSYQALGKK
3D structure
PDB3wmm Structure of the LH1-RC complex from Thermochromatium tepidum at 3.0 angstrom
Chain1
Resolution3.008 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CRT 1 L33 H36 L32 H35
BS02 CA 1 W46 D49 N50 I51 W45 D48 N49 I50
BS03 BCL 1 Q28 H36 W46 Q27 H35 W45
BS04 BCL 1 Q28 L31 G32 I35 H36 Q27 L30 G31 I34 H35
BS05 BCL 1 I11 W12 I10 W11
BS06 CRT 1 K10 I11 L13 K9 I10 L12
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0042314 bacteriochlorophyll binding
GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872 metal ion binding
Biological Process
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0019866 organelle inner membrane
GO:0030076 light-harvesting complex
GO:0030077 plasma membrane light-harvesting complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3wmm, PDBe:3wmm, PDBj:3wmm
PDBsum3wmm
PubMed24670637
UniProtD2Z0P2

[Back to BioLiP]