--> -->

Structure of PDB 7r0w Chain I Binding Site BS05

Receptor Information

>7r0w Chain I (length=222) Species: 1148 (Synechocystis sp. PCC 6803)

MFSKEVTESKVFQWFNDRLEVQAISDDIASKYVPPHVNIFYCLGGLTLTC
FLIQFATGFAMTFYYKPTVTEAFASVQYIMNEVNFGWLIRSIHRWSASMM
VLMMILHVFRVYLTGGFKKPRELTWVVGVMLAVTTVTFGVTGYSLPWDQV
GYWAVKIVSGVPAAIPVVGDQLVTLMRGSESVGQATLTRFYSLHTFVLPW
AIAVLLLLHFLMIRKQGISGPL

IndexError

Python 3.6.8: /usr/bin/python3 Fri Nov 15 17:19:11 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1435     title=pdb2title(pdbid)

   1436     if bs.startswith("BS"):

=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)

   1438     else:

   1439         if lig3:

pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '7r0w', asym_id = 'I', bs = 'BS05', title = 'Cryo-EM structures of the Synechocystis sp. PCC ...lex with and without the regulatory PetP subunit.'

 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='7r0w', asym_id='I', bs='BS05', title='Cryo-EM structures of the Synechocystis sp. PCC ...lex with and without the regulatory PetP subunit.')

    925                 p=subprocess.Popen(cmd,shell=True,stdout=subprocess.PIPE)

    926                 stdout,stderr=p.communicate()

=>  927                 line     =stdout.decode().splitlines()[0]

    928                 items    =line.split('\t')

    929                 rhea     ='\n'.join(["RHEA:"+r for r in items[2].split(',')])

line = '7r0w\tI\tECH\t1', stdout = b'', stdout.decode = <built-in method decode of bytes object>, ).splitlines undefined

IndexError: list index out of range
      args = ('list index out of range',)
      with_traceback = <built-in method with_traceback of IndexError object>