Structure of PDB 3jcs Chain T Binding Site BS03

Receptor Information
>3jcs Chain T (length=154) Species: 5661 (Leishmania donovani) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
THYSRKPQVSSKSAKAKVSDLRCHYKNTFETANVINGMPLRKAQQLYRQV
LAKTRCIPFKRYNGKIGRTAQAKEWGQTKGRWPRKSVVAMMSLLKNAEAN
AIEKGLDPNQMVIKHVQVDQAARMRRRTYRAHGRITPYMCSPCHVQLFMS
EKKE
Ligand information
>3jcs Chain 5 (length=80) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uacgucccucuccaaacgagagaacaugcaugggcuggcaugagcggccu
ugaggccugaaauuucaugcuagggacaca
...<<<<<<<<<.......>>>>....<<<<<<<..<<<......<..>.
....>>>......>>>>>>>..>>>>>...
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3jcs 2.8- angstrom Cryo-EM Structure of the Large Ribosomal Subunit from the Eukaryotic Parasite Leishmania.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		Q46 Q50 T55 R56 R69 A71 Q72 K74 E75
Binding residue
(residue number reindexed from 1)		Q45 Q49 T54 R55 R68 A70 Q71 K73 E74
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3jcs, PDBe:3jcs, PDBj:3jcs
PDBsum3jcs
PubMed27373148
UniProtA0A3S7WY02

[Back to BioLiP]