Structure of PDB 5j4t Chain E Binding Site BS03

Receptor Information
>5j4t Chain E (length=133) Species: 3490 (Artocarpus integer) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GKAFDDGAFTGIREINLSYNKETAIGDFQVVYDLNGSPYVGQNHKSFITG
FTPVKISLDFPSEYIMEVSGYTGNVSGYVVVRSLTFKTNKKTYGPYGVTS
GTPFNLPIENGLIVGFKGSIGYWLDYFSMYLSL
Ligand information
>5j4t Chain H (length=15) Species: 3490 (Artocarpus integer) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
SGISQTVIVGPWGAK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5j4t Distortion of the ligand molecule as a strategy for modulating binding affinity: Further studies involving complexes of jacalin with beta-substituted disaccharides.
Resolution1.94 Å
Binding residue
(original residue number in PDB)
N105 P107 I108 E109 N110 L133
Binding residue
(residue number reindexed from 1)
N105 P107 I108 E109 N110 L133
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0019862 IgA binding
GO:0030246 carbohydrate binding
Biological Process
GO:0008150 biological_process
Cellular Component
GO:0005575 cellular_component

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:5j4t, PDBe:5j4t, PDBj:5j4t
PDBsum5j4t
PubMed28111895
UniProtP18670|LECA_ARTIN Agglutinin alpha chain

[Back to BioLiP]