Structure of PDB 6zj3 Chain Lm Binding Site BS02

Receptor Information
>6zj3 Chain Lm (length=66) Species: 3039 (Euglena gracilis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MRKENCLFSGLPVHPGHGKRFVPTLVQSTRPVLTFVTAKTRKLYLRKKNP
RVIRWTVTYRKLNKKT
Ligand information
>6zj3 Chain LM (length=54) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
caacaccccgcccagaccaggcuggaucugcggcgaguguaagugcagag
guua
.........<<<.......>>>............................
....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6zj3 Cryo-EM structure of the highly atypical cytoplasmic ribosome of Euglena gracilis.
Resolution3.15 Å
Binding residue
(original residue number in PDB)		K39 R54 W55
Binding residue
(residue number reindexed from 1)		K39 R54 W55
External links