Structure of PDB 8h1t Chain G Binding Site BS02

Receptor Information
>8h1t Chain G (length=109) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLP
NIQAVLLPK
Ligand information
>8h1t Chain J (length=167) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ccggcactggaacaggatgtatatatgtgacacgtgcctggagactaggg
agtaatccccttggcggttaaaacgcgggggacagcgcgtacgtgcgttt
aagcggtgctagagctgtctacgaccaattgagcggcctcggcaccggga
ttctccaggggatccgg
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8h1t Basis of the H2AK119 specificity of the Polycomb repressive deubiquitinase.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		R11 R29 R42 V43 G44 A45 T76 R77
Binding residue
(residue number reindexed from 1)		R2 R20 R33 V34 G35 A36 T67 R68
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0031492 nucleosomal DNA binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0008150 biological_process
GO:0031507 heterochromatin formation
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8h1t, PDBe:8h1t, PDBj:8h1t
PDBsum8h1t
PubMed36991118
UniProtP20671|H2A1D_HUMAN Histone H2A type 1-D (Gene Name=H2AC7)

[Back to BioLiP]