Structure of PDB 6gaw Chain BS Binding Site BS02

Receptor Information
>6gaw Chain BS (length=143) Species: 9823 (Sus scrofa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PVENEAVAPEFTNRNPRNLELLAVARKERGWGTVWPSREFWHRLRVIRTQ
HHIEALVEHRNGQVVVSASTREWAIKKHLYSTRNVVACESVGRVLAERCL
EAGINFMVYHPTPWEAASDSIKRLQHAMTEGGVVLREPRRIYE
Ligand information
>6gaw Chain BB (length=67) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
guuaauguagcuuaaucaaagcaaggcacugaaaaugccuagaugagccu
cagcuccauaaacacca
<<<.<<<..<<<.......>>>.<<<<<.......>>>>>....<<<<..
..>>>>>>>.>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6gaw Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		R85 T86 Q87 H88 R108 W110 K113 N121 V122 S155 S157
Binding residue
(residue number reindexed from 1)		R48 T49 Q50 H51 R71 W73 K76 N84 V85 S118 S120
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6gaw, PDBe:6gaw, PDBj:6gaw
PDBsum6gaw
PubMed30089917
UniProtA0A286ZNK1

[Back to BioLiP]