Structure of PDB 7qto Chain B Binding Site BS02

Receptor Information
>7qto Chain B (length=95) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LLIPARIEEELTLTILRGLGISIAGGKGSTPYKGDDEGIFISRVSEEGPA
ARAGVRVGDKLLEVNGVALQGAEHHEAVEALRGGTAVQMRVWRER
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7qto Structural Basis of the Avian Influenza NS1 Protein Interactions with the Cell Polarity Regulator Scribble.
Resolution3.5 Å
Binding residue
(original residue number in PDB)
G737 P768 R801
Binding residue
(residue number reindexed from 1)
G18 P49 R82
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7qto, PDBe:7qto, PDBj:7qto
PDBsum7qto
PubMed35336989
UniProtQ14160|SCRIB_HUMAN Protein scribble homolog (Gene Name=SCRIB)

[Back to BioLiP]