Structure of PDB 5mwe Chain B Binding Site BS02

Receptor Information
>5mwe Chain B (length=61) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SHDCAKVDLENAELRRKLIRTKRAFEDTYEKLRMANKAKAQVEKDIKNQI
LKTHNVLRNVR
Ligand information
>5mwe Chain D (length=27) Species: 7227 (Drosophila melanogaster) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RLECIDVCSVLTNRLEELAGFLNSLLK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5mwe Structural Basis for Mitotic Centrosome Assembly in Flies.
Resolution2.02 Å
Binding residue
(original residue number in PDB)		D1125 I1126 Q1129 K1132 T1133 V1136
Binding residue
(residue number reindexed from 1)		D45 I46 Q49 K52 T53 V56
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:5mwe, PDBe:5mwe, PDBj:5mwe
PDBsum5mwe
PubMed28575671
UniProtP54623|CNN_DROME Centrosomin (Gene Name=cnn)

[Back to BioLiP]