Structure of PDB 5vk0 Chain A Binding Site BS02

Receptor Information
>5vk0 Chain A (length=85) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHI
VYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5vk0 Dithiocarbamate-inspired side chain stapling chemistry for peptide drug design.
Resolution1.8 Å
Binding residue
(original residue number in PDB)
F55 Y56 Q59
Binding residue
(residue number reindexed from 1)
F31 Y32 Q35
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
Gene Ontology
Biological Process
GO:0043066 negative regulation of apoptotic process
GO:0051726 regulation of cell cycle
Cellular Component
GO:0005634 nucleus

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:5vk0, PDBe:5vk0, PDBj:5vk0
PDBsum5vk0
PubMed30809370
UniProtQ00987|MDM2_HUMAN E3 ubiquitin-protein ligase Mdm2 (Gene Name=MDM2)

[Back to BioLiP]