Structure of PDB 3waz Chain A Binding Site BS02

Receptor Information
>3waz Chain A (length=216) Species: 272844 (Pyrococcus abyssi GE5) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EASVSFENGKIVVRLPITRPTSKIRVKKIENGVGIPVSTRKKSFPSDENL
RDYYIEWQISYARDGKYDYELSRMVRLAHEHGILTYNDIYELLKFADDVK
SYLEDKGIRRESTNEELYGFNIYEDVYPVAKKELPSGEFIGIVLKHAQRA
VGYQSMVYVCIPLTNVEPSLAGRVARRNEVVKYEVPVDLMKELLKAFIIA
SETHKNDIVKFLRSII
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3waz A sequence-specific DNA glycosylase mediates restriction-modification in Pyrococcus abyssi.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		T28 S29 K30 R32 E63 Q65 S67 A69 A154 Q155 R156 A157 V158 Q161 M163 Y165
Binding residue
(residue number reindexed from 1)		T21 S22 K23 R25 E56 Q58 S60 A62 A147 Q148 R149 A150 V151 Q154 M156 Y158
Enzymatic activity
Enzyme Commision number ?
External links