Structure of PDB 7s0s Chain h Binding Site BS01

Receptor Information
>7s0s Chain h (length=48) Species: 1772 (Mycolicibacterium smegmatis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKTGIHPEYVDTTVQCGCGHSFTTRSTKQSGTIVVEVCSQCHPFYTGK
Ligand information
>7s0s Chain i (length=118) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
guuacggcgguccauagcggcagggaaacgcccggucccaucccgaaccc
ggaagcuaagccugccagcgccgaugauacuacccauccggguggaaaag
uaggacaccgccgaacac
<<<.<<<<<<<.....<<<<<<<<.....<<<<<...............>
>>..>>....>>>>>>.>>.<<.......<<<<<<....>>>>>>.....
..>>..>>>>>>>>>>..
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7s0s 50S subunit recognition and modification by the Mycobacterium tuberculosis ribosomal RNA methyltransferase TlyA.
Resolution3.05 Å
Binding residue
(original residue number in PDB)		M1 K2 H6
Binding residue
(residue number reindexed from 1)		M1 K2 H6
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7s0s, PDBe:7s0s, PDBj:7s0s
PDBsum7s0s
PubMed35357969
UniProtA0R215|RL31_MYCS2 Large ribosomal subunit protein bL31 (Gene Name=rpmE)

[Back to BioLiP]