Structure of PDB 7qid Chain L Binding Site BS01

Receptor Information
>7qid Chain L (length=30) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FVNQHLCGSHLVEALYLVCGERGFFYTPKT
Ligand information
>7qid Chain K (length=21) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GIVEQCCTSICSLYQLENYCN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7qid Cryo-EM structure of the complete and ligand-saturated insulin receptor ectodomain
Resolution5.0 Å
Binding residue
(original residue number in PDB)		H5 L6 C7 C19 R22 F24 F25 Y26 T27
Binding residue
(residue number reindexed from 1)		H5 L6 C7 C19 R22 F24 F25 Y26 T27
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005179 hormone activity
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:7qid, PDBe:7qid, PDBj:7qid
PDBsum7qid
PubMed31727777
UniProtP01308|INS_HUMAN Insulin (Gene Name=INS)

[Back to BioLiP]