Structure of PDB 5lux Chain L Binding Site BS01

Receptor Information
>5lux Chain L (length=62) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TKDKYRVVYTDHQRLELEKEFHYSRYITIRRKSELAANLGLTERQVKIWF
QNRRAKERKVNK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5lux Impact of cytosine methylation on DNA binding specificities of human transcription factors.
Resolution3.23 Å
Binding residue
(original residue number in PDB)		T153 K154 R158 V159 Y161 R166 R196 Q197 I200 N204
Binding residue
(residue number reindexed from 1)		T1 K2 R6 V7 Y9 R14 R44 Q45 I48 N52
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5lux, PDBe:5lux, PDBj:5lux
PDBsum5lux
PubMed28473536
UniProtP47902|CDX1_HUMAN Homeobox protein CDX-1 (Gene Name=CDX1)

[Back to BioLiP]