Structure of PDB 4v99 Chain GU Binding Site BS01

Receptor Information

>4v99 Chain GU (length=185) Species: 652599 (Panicum mosaic virus strain Kansas 109S) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

QGWQKLSHEEIILQVNSSTAADTIQTIPIIPRLSVPAGDKPIYSGSAPHL
RTIGSAFAIHRWRALSFEWIPSCPTTTPGNLVLRFYPNYSTETPKTLTDL
MDSESLVLVPSLSGKTYRPKIETRGNPPELRNIDATAFSALSDEDKGDYS
VGRLVVGSSKQAVVIQLGLLRMRYSAEMRGATSIS

Ligand information

>4v99 Chain GX (length=17) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

uuaauauuuuuauuuuu

..<<<<....>>>>...

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4v99 The crystallographic structure of Panicum Mosaic Virus (PMV).
Resolution	2.9 Å
Binding residue (original residue number in PDB)	Q54 W56 K58 A117 L118 E230
Binding residue (residue number reindexed from 1)	Q1 W3 K5 A64 L65 E177

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005198	structural molecule activity

	Cellular Component
GO:0019028	viral capsid
GO:0039617	T=3 icosahedral viral capsid

View graph for
Molecular Function

View graph for
Cellular Component

External links

PDB	RCSB:4v99, PDBe:4v99, PDBj:4v99
PDBsum	4v99
PubMed	23123270
UniProt	P89036\|CAPSD_PMVK Capsid protein (Gene Name=ORF3)

[Back to BioLiP]