Structure of PDB 5kc1 Chain G Binding Site BS01

Receptor Information
>5kc1 Chain G (length=33) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QDTLSPINDPLLMSILNRLQFNLNNDIQLKTEG
Ligand information
>5kc1 Chain I (length=29) Species: 4932 (Saccharomyces cerevisiae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DTLSPINDPLLMSILNRLQFNLNNDIQLK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5kc1 Characterization of Atg38 and NRBF2, a fifth subunit of the autophagic Vps34/PIK3C3 complex.
Resolution2.2 Å
Binding residue
(original residue number in PDB)		F140 E151
Binding residue
(residue number reindexed from 1)		F21 E32
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005198 structural molecule activity
GO:0005515 protein binding
GO:0042802 identical protein binding
Biological Process
GO:0006914 autophagy
GO:0016236 macroautophagy
GO:0046854 phosphatidylinositol phosphate biosynthetic process
Cellular Component
GO:0000407 phagophore assembly site
GO:0005737 cytoplasm
GO:0005774 vacuolar membrane
GO:0016020 membrane
GO:0034045 phagophore assembly site membrane
GO:0034271 phosphatidylinositol 3-kinase complex, class III, type I

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5kc1, PDBe:5kc1, PDBj:5kc1
PDBsum5kc1
PubMed27630019
UniProtQ05789|ATG38_YEAST Autophagy-related protein 38 (Gene Name=ATG38)

[Back to BioLiP]