Structure of PDB 7m2v Chain FX Binding Site BS01

Receptor Information

>7m2v Chain FX (length=144) Species: 12881 (Satellite tobacco mosaic virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

NSNVVTMIRAGSYPKVNPTPTWVRAIPFEVSVQSGIAFKVPVGSLFSANF
RTDSFTSVTVMSVRAWTQLTPPVNEYSFVRLKPLFKTGDSTEEFEGRASN
INTRASVGYRIPTNLRQNTVAADNVCEVRSNCRQVALVISCCFN

Ligand information

>7m2v Chain h (length=10) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

uuuuuuuuuu

..........

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7m2v Structures of additional crystal forms of Satellite tobacco mosaic virus grown from a variety of salts.
Resolution	1.8 Å
Binding residue (original residue number in PDB)	S17 V19
Binding residue (residue number reindexed from 1)	S2 V4

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005198	structural molecule activity

	Cellular Component
GO:0019028	viral capsid

View graph for
Molecular Function

View graph for
Cellular Component

External links

PDB	RCSB:7m2v, PDBe:7m2v, PDBj:7m2v
PDBsum	7m2v
PubMed	34866603
UniProt	P17574\|COAT_STMV Coat protein

[Back to BioLiP]