Structure of PDB 8bzm Chain E Binding Site BS01

Receptor Information
>8bzm Chain E (length=95) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SKPPFSYAQLIVQAISSAQDRQLTLSGIYAHITKHYPYYRTADKGWQNSI
RHNLSLNRYFIKVPRSQEEPGKGSFWRIDPASEAKLVEQAFRKRR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8bzm FOXK1-ELF1_heterodimer bound to DNA
Resolution2.69 Å
Binding residue
(original residue number in PDB)		L328 S329 R354 H355 S358 K365 K375 G376 S377
Binding residue
(residue number reindexed from 1)		L25 S26 R51 H52 S55 K62 K72 G73 S74
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8bzm, PDBe:8bzm, PDBj:8bzm
PDBsum8bzm
PubMed
UniProtP85037|FOXK1_HUMAN Forkhead box protein K1 (Gene Name=FOXK1)

[Back to BioLiP]