Structure of PDB 7nt6 Chain D Binding Site BS01

Receptor Information

>7nt6 Chain D (length=368) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

IFEEAASFRSYQSKLGRDGRASAATATLTTKIRIFVPATNSPELRWELTL
FALDVIRSPSAAESMKVGAAFTLISMYSERPGALIRSLLNDPDIEAVIID
VGSMVNGIPVMERRGDKAQEEMEGLMRILKTARDSSKGKTPFVDSRAYGL
RITDMSTLVSAVITIEAQIWILIAKAVTAPDTAEESETRRWAKYVQQKRV
NPFFALTQQWLTEMRNLLSQSLSVRKFMVEILIEVKKGGSAKGRAVEIIS
DIGNYVEETGMAGFFATIRFGLETRYPALALNEFQSDLNTIKSLMLLYRE
IGPRAPYMVLLEESIQTKFAPGGYPLLWSFAMGVATTIDRSMGALNINRG
YLEPMYFRLGQKSARHHA

Ligand information

>7nt6 Chain Z (length=42) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

uuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuuu

..........................................

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7nt6 CryoEM structure of the Nipah virus nucleocapsid assembly.
Resolution	4.3 Å
Binding residue (original residue number in PDB)	T181 L348
Binding residue (residue number reindexed from 1)	T178 L345

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0005198	structural molecule activity
GO:0005515	protein binding
GO:0060090	molecular adaptor activity

	Biological Process
GO:0039689	negative stranded viral RNA replication
GO:0039697	negative stranded viral RNA transcription

	Cellular Component
GO:0019013	viral nucleocapsid
GO:0019029	helical viral capsid
GO:0030430	host cell cytoplasm
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7nt6, PDBe:7nt6, PDBj:7nt6
PDBsum	7nt6
PubMed	34270629
UniProt	Q9IK92\|NCAP_NIPAV Nucleoprotein (Gene Name=N)

[Back to BioLiP]