Structure of PDB 4mji Chain D Binding Site BS01

Receptor Information
>4mji Chain D (length=192) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DPQALSIQEGENATMNCSYKTSINNLQWYRQNSGRGLVHLILIRSNEREK
HSGRLRVTLDTSKKSSSLLITASRAADTASYFCATDDDSARQLTFGSGTQ
LTVLPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYIT
DKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTF
Ligand information
>4mji Chain C (length=8) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
TAFTIPSI
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4mji Molecular basis of a dominant T cell response to an HIV reverse transcriptase 8-mer epitope presented by the protective allele HLA-B*51:01
Resolution2.99 Å
Binding residue
(original residue number in PDB)		A96 R97
Binding residue
(residue number reindexed from 1)		A90 R91
Enzymatic activity
Enzyme Commision number ?
External links