Structure of PDB 1knz Chain D Binding Site BS01

Receptor Information
>1knz Chain D (length=138) Species: 10923 (Simian rotavirus A/SA11) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSMESTQQMAVSIINSSFEAAVVAATSALENMGIEYDYQDIYSRVKNKFD
FVMDDSGVKNNPIGKAITIDQALNDTSRPAKLDEDVNKLRMMLSSKGIDQ
KMRVLNACFSVKRIPGKSSSIIKCTKLMRDKLERGEVE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1knz Recognition of the rotavirus mRNA 3' consensus by an asymmetric NSP3 homodimer.
Resolution2.45 Å
Binding residue
(original residue number in PDB)		D98 R105 R118 V119 K146 R149
Binding residue
(residue number reindexed from 1)		D83 R90 R103 V104 K131 R134
Binding affinityPDBbind-CN: Kd=79nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:1knz, PDBe:1knz, PDBj:1knz
PDBsum1knz
PubMed11792322
UniProtP03536|NSP3_ROTS1 Non-structural protein 3

[Back to BioLiP]