Structure of PDB 6iz8 Chain C Binding Site BS01

Receptor Information
>6iz8 Chain C (length=234) Species: 287 (Pseudomonas aeruginosa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HHHHSSGLVPRGSHMLNSVGFYGKLAGRGDFVSRGLPNTFVEPWDAWLAS
GMRASQDELGAAWLDAYLTSPLWRFAIAPGLLGGEAVTGVVMPSIDRVGR
YFPLTVACLLPANADLGGLVGGDDGWFEQVESLLLSTLEPEAEVEAFEQA
VAQLPAPPCGPRIEQSLISGNLLRSEAVTPAQRLAALAQHACDGASHWWG
RGSARISAGLMRYQGLPPAPAFGRFLTGEFPGIP
Ligand information
>6iz8 Chain F (length=12) Species: 287 (Pseudomonas aeruginosa) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
HHHHSSGLVPRG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6iz8 Crystal Structure of the Type VI Secretion System Accessory Protein TagF from Pseudomonas Aeruginosa.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		H-12 H-11 S-10 S-9 V-6 H-1 S3 G20 P22
Binding residue
(residue number reindexed from 1)		H3 H4 S5 S6 V9 H14 S18 G35 P37
Enzymatic activity
Enzyme Commision number ?
External links