Structure of PDB 3zql Chain C Binding Site BS01

Receptor Information

>3zql Chain C (length=236) Species: 1890 (Streptomyces antibioticus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

VSIWMHPEPAGRRSARSHRTLSRDQIVRAAVKVADTEGVEAASMRRVAAE
LGAGTMSLYYYVPTKEDLVELMVDEVIGETRLPDRPGPDWRAALTLAANE
KRALWLRHPWLATAWRNGHPVWGPNSLRQQEFVLGTLGVFDLQVDELLSL
IGLYNGYVESFVRNEVGWLEEARRTKVDMREWMRRSGPYAQQLVDSGEYP
MFARVLAETVAPHMGPDQRFRSGLERLLDSIGASLD

Ligand information

>3zql Chain G (length=17) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ttcgtacgccgtacgaa

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3zql The Crystal Structure of the Tetr Family Transcriptional Repressor Simr Bound to DNA and the Role of a Flexible N-Terminal Extension in Minor Groove Binding.
Resolution	2.99 Å
Binding residue (original residue number in PDB)	S49 M50 R51 M62 Y65 T70 K71
Binding residue (residue number reindexed from 1)	S43 M44 R45 M56 Y59 T64 K65

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000976	transcription cis-regulatory region binding
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity
GO:0046872	metal ion binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription
GO:0045892	negative regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:3zql, PDBe:3zql, PDBj:3zql
PDBsum	3zql
PubMed	21835774
UniProt	Q9AMH9

[Back to BioLiP]