Structure of PDB 3clc Chain C Binding Site BS01

Receptor Information
>3clc Chain C (length=77) Species: 211595 (Enterobacter sp. RFL1396) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ESFLLSKVSFVIKKIRLEKGMTQEDLAYKSNLDRTYISGIERNSRNLTIK
SLELIMKGLEVSDVVFFEMLIKEILKH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3clc Structural analysis of the genetic switch that regulates the expression of restriction-modification genes.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		R17 T23 Q24 E25 T36 S39 R43
Binding residue
(residue number reindexed from 1)		R16 T22 Q23 E24 T35 S38 R42
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3clc, PDBe:3clc, PDBj:3clc
PDBsum3clc
PubMed18644840
UniProtQ8GGH0

[Back to BioLiP]