Structure of PDB 5wyi Chain B Binding Site BS01

Receptor Information
>5wyi Chain B (length=138) Species: 285006 (Saccharomyces cerevisiae RM11-1a) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GARIKTLSVSRPIIYGNTAKKMGSVKPAPAEHTHLWTIFVRGPQNEDISY
FIKKVVFKLHDTYPNPVRSIEAPPFELTETGWGEFDINIKVYFVEEANEK
VLNFYHRLRLHPEVSSVYFDEIVFNEPNEEFFKILMSR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5wyi The Yaf9 YEATS domain Recognizing H3K122suc Peptide
Resolution2.0 Å
Binding residue
(original residue number in PDB)		H67 T69 W89 G90 E91 F92 R114 H118
Binding residue
(residue number reindexed from 1)		H60 T62 W82 G83 E84 F85 R107 H111
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Biological Process
External links
PDB RCSB:5wyi, PDBe:5wyi, PDBj:5wyi
PDBsum5wyi
PubMed
UniProtB3LNW5

[Back to BioLiP]