Structure of PDB 2pux Chain B Binding Site BS01

Receptor Information
>2pux Chain B (length=258) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IVEGWDAEKGIAPWQVMLFRKSPQELLCGASLISDRWVLTAAHCILYPPW
DKNFTENDLLVRIGKHSRTRYERNVEKISMLEKIYVHPRYNWRENLDRDI
ALLKLKKPVPFSDYIHPVCLPDKQTVTSLLRAGYKGRVTGWGNLRETWTT
NINEIQPSVLQVVNLPIVERPVCKASTRIRITDNMFCAGFKVNDTKRGDA
CEGDAGGPFVMKSPFNNRWYQMGIVSWGEGCDRKGKYGFYTHVFRLKRWI
QKVIDQFG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2pux Crystal structures of murine thrombin in complex with the extracellular fragments of murine protease-activated receptors PAR3 and PAR4.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		F34 R73 T74 R75 Y76 R77A K81 I82
Binding residue
(residue number reindexed from 1)		F19 R68 T69 R70 Y71 R73 K77 I78
Enzymatic activity
Catalytic site (original residue number in PDB) H57 D102 E192 G193 D194 A195 G196
Catalytic site (residue number reindexed from 1) H43 D99 E202 G203 D204 A205 G206
Enzyme Commision number 3.4.21.5: thrombin.
Gene Ontology
Molecular Function
GO:0004252 serine-type endopeptidase activity
GO:0005509 calcium ion binding
Biological Process
GO:0006508 proteolysis
GO:0007596 blood coagulation

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2pux, PDBe:2pux, PDBj:2pux
PDBsum2pux
PubMed17606903
UniProtP19221|THRB_MOUSE Prothrombin (Gene Name=F2)

[Back to BioLiP]