Structure of PDB 1ov3 Chain B Binding Site BS01

Receptor Information
>1ov3 Chain B (length=127) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SPEFIILQTYRAIADYEKTSGSEMALSTGDVVEVVEKSESGWWFCQMKAK
RGWIPASFLEPLDSPDEPNYAGEPYVAIKAYTAVEGDEVSLLEGEAVEVI
HKLLDGWWVIRKDDVTGYFPSMYLQKS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1ov3 Molecular basis of phosphorylation-induced activation of the NADPH oxidase
Resolution1.8 Å
Binding residue
(original residue number in PDB)		W204 P206 S208 F209 E241 D243 E244 D261 W263 Y274 M278 Y279
Binding residue
(residue number reindexed from 1)		W53 P55 S57 F58 E85 D87 E88 D105 W107 Y118 M122 Y123
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1ov3, PDBe:1ov3, PDBj:1ov3
PDBsum1ov3
PubMed12732142
UniProtP14598|NCF1_HUMAN Neutrophil cytosol factor 1 (Gene Name=NCF1)

[Back to BioLiP]