Structure of PDB 8txf Chain A Binding Site BS01

Receptor Information
>8txf Chain A (length=295) Species: 317 (Pseudomonas syringae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FRALPGPSQRQLEVYDQCLIGAARWPDDSSKSNTPENRAYCQSMYNSIRS
AGDEISRGGITSFEELWGRATEWRLSKLQRGEPLYSAFASERTSDTDAVT
PLVKPYKSVLARVVDHEDAHDEIMQDNLFGDLNVKVYRQTAYLHGNVIPL
NTFRVATDTEYLRDRVAHLRTELGAKALKQHLQRYNPDRIDHTNASYLPI
IKDHLNDLYRQAISSDLSQAELISLIARTHWWAASAMPDQRGSAAKAEFA
ARAIASAHGIELPPFRNGNVSDIEAMLSGEEEFVEKYRSLLDSDC
Ligand information
>8txf Chain B (length=25) Species: 3702 (Arabidopsis thaliana) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
APKFGDWDENNPSSADGYTHIFNKV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8txf Pseudomonas effector AvrB is a glycosyltransferase that rhamnosylates plant guardee protein RIN4.
Resolution1.29 Å
Binding residue
(original residue number in PDB)		S119 D120 T121 D122 A123 V124 T125 P126 V128 K132 L135 V139 T184 L187 R188 R195 A200 L203 K204 L207 Q208 R209 P212 D213 N219 R266
Binding residue
(residue number reindexed from 1)		S94 D95 T96 D97 A98 V99 T100 P101 V103 K107 L110 V114 T159 L162 R163 R170 A175 L178 K179 L182 Q183 R184 P187 D188 N194 R241
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0005576 extracellular region

View graph for
Cellular Component
External links
PDB RCSB:8txf, PDBe:8txf, PDBj:8txf
PDBsum8txf
PubMed38354245
UniProtP13835|AVRB_PSESG Avirulence protein B (Gene Name=avrB)

[Back to BioLiP]