Structure of PDB 8qtc Chain A Binding Site BS01

Receptor Information
>8qtc Chain A (length=238) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SGREEFVYMAKLAEQAERYEEMVEFMEKVSAAVDGDELTVEERNLLSVAY
KNVIGARRASWRIISSIEQKEESRGNDDHVTAIREYRSKIETELSGICDG
ILKLLDSRLIPAAASGDSKVFYLKMKGDYHRYLAEFKTGQERKDAAEHTL
AAYKSAQDIANAELAPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAF
DEAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSDMQD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8qtc Mechanistic insights into the function of 14-3-3 proteins as negative regulators of brassinosteroid signaling.
Resolution3.5 Å
Binding residue
(original residue number in PDB)		K53 R60 R133 Y134 N179 N230
Binding residue
(residue number reindexed from 1)		K51 R58 R131 Y132 N177 N228
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
Biological Process
GO:0009742 brassinosteroid mediated signaling pathway
Cellular Component
GO:0000325 plant-type vacuole
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005794 Golgi apparatus
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8qtc, PDBe:8qtc, PDBj:8qtc
PDBsum8qtc
PubMed38783418
UniProtQ01525|14332_ARATH 14-3-3-like protein GF14 omega (Gene Name=GRF2)

[Back to BioLiP]