Structure of PDB 8bbk Chain A Binding Site BS01

Receptor Information
>8bbk Chain A (length=274) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GKLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQ
YDLPYPEAIFELPFFFHNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKG
LLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRA
DVMADRVPRCPVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGT
SLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGV
ESLVELLGWTEEMRDLVQRETGKL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8bbk Molecular Mechanism of Sirtuin 1 Modulation by the AROS Protein.
Resolution3.27 Å
Binding residue
(original residue number in PDB)		F180 H248 V292 F294 G295 E296
Binding residue
(residue number reindexed from 1)		F60 H128 V172 F174 G175 E176
Enzymatic activity
Enzyme Commision number 2.3.1.286: protein acetyllysine N-acetyltransferase.
Gene Ontology
Molecular Function
GO:0003950 NAD+-protein poly-ADP-ribosyltransferase activity
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0016740 transferase activity
GO:0017136 NAD-dependent histone deacetylase activity
GO:0019899 enzyme binding
GO:0034979 NAD-dependent protein lysine deacetylase activity
GO:0043565 sequence-specific DNA binding
GO:0046872 metal ion binding
GO:0070403 NAD+ binding
GO:1990404 NAD+-protein ADP-ribosyltransferase activity
Biological Process
GO:0006338 chromatin remodeling
GO:0006476 protein deacetylation
GO:0009060 aerobic respiration
GO:0032024 positive regulation of insulin secretion
GO:0034983 peptidyl-lysine deacetylation
GO:0070373 negative regulation of ERK1 and ERK2 cascade
GO:1901671 positive regulation of superoxide dismutase activity
GO:1902553 positive regulation of catalase activity
GO:2000304 positive regulation of ceramide biosynthetic process
GO:2000378 negative regulation of reactive oxygen species metabolic process
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005739 mitochondrion
GO:0005759 mitochondrial matrix
GO:0032991 protein-containing complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8bbk, PDBe:8bbk, PDBj:8bbk
PDBsum8bbk
PubMed36361557
UniProtQ9NTG7|SIR3_HUMAN NAD-dependent protein deacetylase sirtuin-3, mitochondrial (Gene Name=SIRT3)

[Back to BioLiP]