Structure of PDB 7tfj Chain A Binding Site BS01

Receptor Information
>7tfj Chain A (length=396) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
REEDKLWTVKYAPTNLQQVCGNKGSVMKLKNWLANWENSKKNSFKHAGKD
GSGVFRAAMLYGPPGIGKTTAAHLVAQELGYDILEQNASDVRSKTLLNAG
VKNALDNMSVVGYFKHQNLNGKHFVIIMDEVDGMSGGDRGGVGQLAQFCR
KTSTPLILICNERNLPKMRPFDRVCLDIQFRRPDANSIKSRLMTIAIREK
FKLDPNVIDRLIQTTRGDIRQVINLLSTISTTTKTINHENINEISKAWEK
NIALKPFDIAHKMLDGQIYSDIGSRNFTLNDKIALYFDDFDFTPLMIQEN
YLSTRPSVLKPGQSHLEAVAEAANCISLGDIVEKKIRSSEQLWSLLPLHA
VLSSVYPASKVAGHMAGRINFTAWLGQNSKSAKYYRLLQEIHYHTR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7tfj Cryo-EM structures reveal that RFC recognizes both the 3'- and 5'-DNA ends to load PCNA onto gaps for DNA repair.
Resolution3.3 Å
Binding residue
(original residue number in PDB)
V382 S384 T386 R632 Q636 W638 L670 N673 S674
Binding residue
(residue number reindexed from 1)
V91 S93 T95 R337 Q341 W343 L375 N378 S379
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003689 DNA clamp loader activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0016887 ATP hydrolysis activity
Biological Process
GO:0000278 mitotic cell cycle
GO:0006260 DNA replication
GO:0006261 DNA-templated DNA replication
GO:0006271 DNA strand elongation involved in DNA replication
GO:0006272 leading strand elongation
GO:0006281 DNA repair
GO:0006298 mismatch repair
GO:0051301 cell division
Cellular Component
GO:0005634 nucleus
GO:0005663 DNA replication factor C complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7tfj, PDBe:7tfj, PDBj:7tfj
PDBsum7tfj
PubMed35829698
UniProtP38630|RFC1_YEAST Replication factor C subunit 1 (Gene Name=RFC1)

[Back to BioLiP]