Structure of PDB 7r9f Chain A Binding Site BS01

Receptor Information
>7r9f Chain A (length=379) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LPKRKVAVMVGYCGTGYHGMQYNPPNPTIESALFKAFVEAGAISKDNSFM
RAARTDKGVHAGGNLISLKMIIEDPDIKQKINEKLPEGIRVWDIERVNKA
FDCRKMCSSRWYEYLLPTYSLIGPKPGSILYRDIEESKTELLDEDLESKE
FWEEFKKDANEKFSTEEIEAILEELYQKVKKYKQLENAHRRRYRISAAKL
AKFRASTSQYLGAHNFHNFTLGKDFKEPSAIRFMKDIKVSDPFVIGDAQT
EWISIKIHGQSFMLHQIRKMVSMATLITRCGCPVERISQAYGQQKINIPK
APALGLLLEAPVFEGYNKRLEQFGYKAIDFSKYQDEVDKFKMKHIYDKIY
KEEVDENVFNAFFSYIDSFKSIFEFLTAK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7r9f Wild-type yeast Pseudouridine Synthase bound to 5-Fluorouracil RNA
Resolution2.89 Å
Binding residue
(original residue number in PDB)		H89 Q92 N94 N97 R132 D134 K135 Y459
Binding residue
(residue number reindexed from 1)		H18 Q21 N23 N26 R54 D56 K57 Y365
Enzymatic activity
Enzyme Commision number 5.4.99.-
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0008270 zinc ion binding
GO:0009982 pseudouridine synthase activity
GO:0016853 isomerase activity
GO:0106029 tRNA pseudouridine synthase activity
GO:0106032 snRNA pseudouridine synthase activity
Biological Process
GO:0001522 pseudouridine synthesis
GO:0006397 mRNA processing
GO:0006400 tRNA modification
GO:0008033 tRNA processing
GO:0009451 RNA modification
GO:0031119 tRNA pseudouridine synthesis
GO:0031120 snRNA pseudouridine synthesis
GO:1990481 mRNA pseudouridine synthesis
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0043231 intracellular membrane-bounded organelle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7r9f, PDBe:7r9f, PDBj:7r9f
PDBsum7r9f
PubMed37939088
UniProtQ12211|PUS1_YEAST tRNA pseudouridine synthase 1 (Gene Name=PUS1)

[Back to BioLiP]