Structure of PDB 7ntj Chain A Binding Site BS01

Receptor Information
>7ntj Chain A (length=86) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPLGSKIVRIEKARDIPLGATVRNEMDSVIISRIVKGGAAEKSGLLHEGD
EVLEINGIEIRGKDVNEVFDLLSDMHGTLTFVLIPS
Ligand information
>7ntj Chain C (length=7) Species: 694009 (Severe acute respiratory syndrome-related coronavirus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GVPDLLV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ntj Structural basis of coronavirus E protein interactions with human PALS1 PDZ domain.
Resolution1.74 Å
Binding residue
(original residue number in PDB)		P266 L267 A269 T270 V271 R272 S281 V314 N315 F318
Binding residue
(residue number reindexed from 1)		P17 L18 A20 T21 V22 R23 S32 V65 N66 F69
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7ntj, PDBe:7ntj, PDBj:7ntj
PDBsum7ntj
PubMed34117354
UniProtQ8N3R9|PALS1_HUMAN Protein PALS1 (Gene Name=PALS1)

[Back to BioLiP]