Structure of PDB 6k5r Chain A Binding Site BS01

Receptor Information
>6k5r Chain A (length=77) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQ
PINETDTPAQLEMEDEDTIDVFQQQTG
Ligand information
>6k5r Chain B (length=12) Species: 10360 (Human herpesvirus 5 strain AD169) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DTAGCIVISDSE
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6k5r Casein kinase-2-mediated phosphorylation increases the SUMO-dependent activity of the cytomegalovirus transactivator IE2.
ResolutionN/A
Binding residue
(original residue number in PDB)		H17 V29 V30 Q31 F32 K33 I34 K35 T38 P39 K42 R50
Binding residue
(residue number reindexed from 1)		H2 V14 V15 Q16 F17 K18 I19 K20 T23 P24 K27 R35
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:6k5r, PDBe:6k5r, PDBj:6k5r
PDBsum6k5r
PubMed31371453
UniProtP55854|SUMO3_HUMAN Small ubiquitin-related modifier 3 (Gene Name=SUMO3)

[Back to BioLiP]