Structure of PDB 6gd5 Chain A Binding Site BS01

Receptor Information
>6gd5 Chain A (length=117) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VTGDTDQPIHIESDQQSLDMQGNVVTFTGNVIVTQGTIKINADKVVVTRP
GGEQGKEVIDGYGKPATFYQMQDNGKPVEGHASQMHYELAKDFVVLTGNA
YLQQVDSNIKGDKITYL
Ligand information
>6gd5 Chain B (length=21) Species: 29025 (Podisus maculiventris) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GSKKPVPIIYCNRRTGKCQRM
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6gd5 Thanatin targets the intermembrane protein complex required for lipopolysaccharide transport inEscherichia coli.
ResolutionN/A
Binding residue
(original residue number in PDB)		Q34 P35 I36 H37 I38 E39 S40 D41 Q43 V52 F54 R76 Q81 G82 E84
Binding residue
(residue number reindexed from 1)		Q7 P8 I9 H10 I11 E12 S13 D14 Q16 V25 F27 R49 Q54 G55 E57
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0001530 lipopolysaccharide binding
Biological Process
GO:0015920 lipopolysaccharide transport
Cellular Component
GO:0042597 periplasmic space

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6gd5, PDBe:6gd5, PDBj:6gd5
PDBsum6gd5
PubMed30443594
UniProtP0ADV1|LPTA_ECOLI Lipopolysaccharide export system protein LptA (Gene Name=lptA)

[Back to BioLiP]