Structure of PDB 6el8 Chain A Binding Site BS01

Receptor Information
>6el8 Chain A (length=89) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MPKPIYSYSILIFMALKNSKTGSLPVSEIYNFMTEHFPYFKTAPDGWKNS
VRHNLSLNKCFEKVENKSKGCLWALNPAKIDKMQEELQK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6el8 Crystal structure of the Forkhead domain of human FOXN1 in complex with DNA
Resolution1.61 Å
Binding residue
(original residue number in PDB)		R320 H321 S324 K331 G343 C344 W346
Binding residue
(residue number reindexed from 1)		R52 H53 S56 K63 G70 C71 W73
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:6el8, PDBe:6el8, PDBj:6el8
PDBsum6el8
PubMed
UniProtO15353|FOXN1_HUMAN Forkhead box protein N1 (Gene Name=FOXN1)

[Back to BioLiP]