Structure of PDB 5vk0 Chain A Binding Site BS01

Receptor Information
>5vk0 Chain A (length=85) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHI
VYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5vk0 Dithiocarbamate-inspired side chain stapling chemistry for peptide drug design.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		L54 I61 M62 Q72 H73 V93 H96 Y100
Binding residue
(residue number reindexed from 1)		L30 I37 M38 Q48 H49 V69 H72 Y76
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
Gene Ontology
Biological Process
GO:0043066 negative regulation of apoptotic process
GO:0051726 regulation of cell cycle
Cellular Component
GO:0005634 nucleus

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5vk0, PDBe:5vk0, PDBj:5vk0
PDBsum5vk0
PubMed30809370
UniProtQ00987|MDM2_HUMAN E3 ubiquitin-protein ligase Mdm2 (Gene Name=MDM2)

[Back to BioLiP]