Structure of PDB 5v21 Chain A Binding Site BS01

Receptor Information
>5v21 Chain A (length=245) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PSCVMDDFRDPQRWKECAKQGKMPCYFDLIEENVYLTERQCECTPLSKDE
RAQGEIACGEDCLNRLLMIECSSRCPNGDYCSNRRFQRKQHADVEVILTE
KKGWGLRAAKDLPSNTFVLEYCGEVLDHKEFKARVKEYARNKNIHYYFMA
LKNDEIIDATQKGNCSRFMNHSCEPNCETQKWTVNGQLRVGFFTTKLVPS
GSELTFDYQFQRYGKEAQKCFCGSANCRGYLGGENRVSIRAAGGK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5v21 Molecular basis for the role of oncogenic histone mutations in modulating H3K36 methylation.
Resolution2.415 Å
Binding residue
(original residue number in PDB)		Y1579 F1589 Y1604 F1606 M1607 A1608 E1636 T1637 T1653 D1665 Y1666 Q1667 F1668 Q1669 R1670 Y1671 G1672 K1673 E1674 A1700
Binding residue
(residue number reindexed from 1)		Y121 F131 Y146 F148 M149 A150 E178 T179 T195 D207 Y208 Q209 F210 Q211 R212 Y213 G214 K215 E216 A242
Enzymatic activity
Catalytic site (original residue number in PDB) Y1579 Y1666
Catalytic site (residue number reindexed from 1) Y121 Y208
Enzyme Commision number 2.1.1.-
2.1.1.359: [histone H3]-lysine(36) N-trimethyltransferase.
Gene Ontology
Molecular Function
GO:0016279 protein-lysine N-methyltransferase activity
GO:0042054 histone methyltransferase activity
GO:0046975 histone H3K36 methyltransferase activity
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:5v21, PDBe:5v21, PDBj:5v21
PDBsum5v21
PubMed28256625
UniProtQ9BYW2|SETD2_HUMAN Histone-lysine N-methyltransferase SETD2 (Gene Name=SETD2)

[Back to BioLiP]