Structure of PDB 5hky Chain A Binding Site BS01

Receptor Information

>5hky Chain A (length=303) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PGTVDKKMVEKCWKLMDKVVRLCQNPKLALKNSPPYILDLLPDTYQHLRT
ILSRYEGKMETLGENEYFRVFMENLMKKTKQTISLFKEGKERMYEENSQP
RRNLTKLSLIFSHMLAELKGIFPSGLFQGDTFRITKADAAEFWRKAFGEK
TIVPWKSFRQALHEVHPISSGLEAMALKSTIDLTCNDYISVFEFDIFTRL
FQPWSSLLRNWNSLAVTHPGYMAFLTYDEVKARLQKFIHKPGSYIFRLSC
TRLGQWAIGYVTADGNILQTIPHNKPLFQALIDGFREGFYLFPDGRNQNP
DLT

Ligand information

>5hky Chain B (length=22) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

HVLSLDQIRAIRNTNEYTEGPT

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5hky Crystal structure of c-Cbl TKBD domain in complex with SPRY2 peptide (36-60, pY55) Refined to 1.8A Resolution (P6 form)
Resolution	1.8 Å
Binding residue (original residue number in PDB)	D64 V67 R68 Q71 P81 D86 L88 P89 Y92 Y274 R294 C297 T298 Y307 Q316 T317 I318 E334 F336 Y337
Binding residue (residue number reindexed from 1)	D17 V20 R21 Q24 P34 D39 L41 P42 Y45 Y227 R247 C250 T251 Y260 Q269 T270 I271 E287 F289 Y290

Enzymatic activity

Enzyme Commision number

2.3.2.27: RING-type E3 ubiquitin transferase.

Gene Ontology

	Molecular Function
GO:0001784	phosphotyrosine residue binding
GO:0004842	ubiquitin-protein transferase activity
GO:0005509	calcium ion binding

	Biological Process
GO:0007166	cell surface receptor signaling pathway
GO:0023051	regulation of signaling

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:5hky, PDBe:5hky, PDBj:5hky
PDBsum	5hky
PubMed
UniProt	P22681\|CBL_HUMAN E3 ubiquitin-protein ligase CBL (Gene Name=CBL)

[Back to BioLiP]