Structure of PDB 5h5s Chain A Binding Site BS01

Receptor Information
>5h5s Chain A (length=164) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DWRAARSMHEFSAKDIDGHMVNLDKYRGFVSIVTNVASQDGKTEVNYTQL
VDLHARYAERGLRILAFPSNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKI
EVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGVVVKRYGPM
EEPLVIEKDLPHYF
Ligand information
>5h5s Chain B (length=14) Species: 10760 (Escherichia phage T7) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
VPCPYLPLWNCAGK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5h5s Discovery of GPX4 inhibitory peptides from random peptide T7 phage display and subsequent structural analysis
Resolution1.85 Å
Binding residue
(original residue number in PDB)		G155 I156 L157 K162 W163 R179 P182 M183
Binding residue
(residue number reindexed from 1)		G122 I123 L124 K129 W130 R146 P149 M150
Enzymatic activity
Catalytic site (original residue number in PDB) D73 Q108 W163
Catalytic site (residue number reindexed from 1) D40 Q75 W130
Enzyme Commision number 1.11.1.12: phospholipid-hydroperoxide glutathione peroxidase.
1.11.1.9: glutathione peroxidase.
Gene Ontology
Molecular Function
GO:0004601 peroxidase activity
Biological Process
GO:0006979 response to oxidative stress

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5h5s, PDBe:5h5s, PDBj:5h5s
PDBsum5h5s
PubMed27836545
UniProtP36969|GPX4_HUMAN Phospholipid hydroperoxide glutathione peroxidase GPX4 (Gene Name=GPX4)

[Back to BioLiP]