Structure of PDB 5b75 Chain A Binding Site BS01

Receptor Information
>5b75 Chain A (length=119) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LPHEKDKPVAEPIPICSFCLGTKEQNREKKPEELISCADCGNSGHPSCLK
FSPELTVRVKALRWQCIECKTCSSCRDQGKNADNMLFCDSCDRGFHMECC
DPPLTRMPKGMWICQICRP
Ligand information
>5b75 Chain B (length=25) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ARTKQTARKSTGGKAPRKQLATKAA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5b75 Selective recognition of histone crotonylation by double PHD fingers of MOZ and DPF2
Resolution1.704 Å
Binding residue
(original residue number in PDB)		I208 S210 F211 L213 N235 S236 K243 W257 I260 E261 A275 D276 M278 L279 F280 C281 D282 D285 M300 P301 G303
Binding residue
(residue number reindexed from 1)		I15 S17 F18 L20 N42 S43 K50 W64 I67 E68 A82 D83 M85 L86 F87 C88 D89 D92 M107 P108 G110
Enzymatic activity
Enzyme Commision number 2.3.1.48: histone acetyltransferase.
External links
PDB RCSB:5b75, PDBe:5b75, PDBj:5b75
PDBsum5b75
PubMed27775714
UniProtQ92794|KAT6A_HUMAN Histone acetyltransferase KAT6A (Gene Name=KAT6A)

[Back to BioLiP]