Structure of PDB 4ps1 Chain A Binding Site BS01

Receptor Information
>4ps1 Chain A (length=238) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALT
TTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDKG
IIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPV
TRYIPDEADFLLGMATVNNCVSYRNPAEGTWYIQSLCQSLRERCPRGDDI
LTILTEVNYEVSNKDDKKNMGKQMPQPTFTLRKKLVFP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4ps1 Selective inhibition of initiator versus executioner caspases using small peptides containing unnatural amino acids.
Resolution1.731 Å
Binding residue
(original residue number in PDB)		R258 R260 H317 Q358 C360 S411 R413 P415 W420 D455
Binding residue
(residue number reindexed from 1)		R37 R39 H96 Q137 C139 S172 R174 P176 W181 D216
Enzymatic activity
Catalytic site (original residue number in PDB) R258 D259 H317 G318 C360 Q361
Catalytic site (residue number reindexed from 1) R37 D38 H96 G97 C139 Q140
Enzyme Commision number 3.4.22.61: caspase-8.
Gene Ontology
Molecular Function
GO:0004197 cysteine-type endopeptidase activity
GO:0008234 cysteine-type peptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4ps1, PDBe:4ps1, PDBj:4ps1
PDBsum4ps1
PubMed25079698
UniProtQ14790|CASP8_HUMAN Caspase-8 (Gene Name=CASP8)

[Back to BioLiP]