Structure of PDB 3p9h Chain A Binding Site BS01

Receptor Information
>3p9h Chain A (length=141) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SAVSESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYGGSRELMN
LTGTIPVPYRGNTYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTGKHVD
ANGKIYLPYLHEWKHPQSDLLGLIQVMIVVFGDEPPVFSRP
Ligand information
>3p9h Chain B (length=9) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PEPTAPPEE
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3p9h Elucidation of New Binding Interactions with the Tumor Susceptibility Gene 101 (Tsg101) Protein Using Modified HIV-1 Gag-p6 Derived Peptide Ligands.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		D34 T56 T58 Y63 R64 Y68 N69 P71 K90 M95 P139 V141 F142 S143
Binding residue
(residue number reindexed from 1)		D34 T52 T54 Y59 R60 Y64 N65 P67 K86 M91 P135 V137 F138 S139
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0015031 protein transport
GO:0036211 protein modification process

View graph for
Biological Process
External links
PDB RCSB:3p9h, PDBe:3p9h, PDBj:3p9h
PDBsum3p9h
PubMed21643473
UniProtQ99816|TS101_HUMAN Tumor susceptibility gene 101 protein (Gene Name=TSG101)

[Back to BioLiP]