Structure of PDB 3okh Chain A Binding Site BS01

Receptor Information

>3okh Chain A (length=227) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ELTPDQQTLLHFIMDSYNKQRMPQEITNKILKEAFSAEENFLILTEMATN
HVQVLVEFTKKLPGFQTLDHEDQIALLKGSAVEAMFLRSAEIFNKKLPSG
HSDLLEARIRNSGISDEYITPMFSFYKSIGELKMTQEEYALLTAIVILSP
DRYIKDREAVEKLQEPLLDVLQKLCKIHQPENPQHFACLLGRLTELRTFN
HHHAEMLMSWRVNDHKFTPLLCEIWDV

Ligand information

>3okh Chain B (length=10) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

HQLLRYLLDK

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3okh Discovery of novel and orally active FXR agonists for the potential treatment of dyslipidemia & diabetes
Resolution	2.5 Å
Binding residue (original residue number in PDB)	V303 K307 H317 Q320 I321 L468 E471
Binding residue (residue number reindexed from 1)	V56 K60 H70 Q73 I74 L220 E223

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0004879	nuclear receptor activity
GO:0032052	bile acid binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription
GO:0038183	bile acid signaling pathway

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:3okh, PDBe:3okh, PDBj:3okh
PDBsum	3okh
PubMed	21134747
UniProt	Q96RI1\|NR1H4_HUMAN Bile acid receptor (Gene Name=NR1H4)

[Back to BioLiP]