Structure of PDB 3gib Chain A Binding Site BS01

Receptor Information
>3gib Chain A (length=64) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVY
KHAISTVVPSRPVS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB3gib Structure of Escherichia coli Hfq bound to polyriboadenylate RNA
Resolution2.4 Å
Binding residue
(original residue number in PDB)		Y25 G29 I30 K31 L32 Q33 N48 Q52 T61
Binding residue
(residue number reindexed from 1)		Y20 G24 I25 K26 L27 Q28 N43 Q47 T56
Binding affinityPDBbind-CN: Kd=1.4nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3gib, PDBe:3gib, PDBj:3gib
PDBsum3gib
PubMed19889981
UniProtP0A6X3|HFQ_ECOLI RNA-binding protein Hfq (Gene Name=hfq)

[Back to BioLiP]